Recombinant Human ID2 protein, His-SUMO-tagged

• Cat.No.: ID2-3063H
• Product Overview: Recombinant Human ID2 protein(Q02363)(1-134aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-134aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.9 kDa
• AA Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ID2 inhibitor of DNA binding 2, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID2
• Synonyms: ID2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-2; bHLHb26; cell growth inhibiting gene 8; GIG8; helix-loop-helix protein ID2; cell growth-inhibiting gene 8; inhibitor of differentiation 2; DNA-binding protein inhibitor ID2; class B basic helix-loop-helix protein 26; ID2A; ID2H; MGC26389
• Gene ID: 3398
• mRNA Refseq: NM_002166
• Protein Refseq: NP_002157
• MIM: 600386
• UniProt ID: Q02363