Recombinant Human ICT1 protein, His-SUMO-tagged

• Cat.No.: ICT1-4369H
• Product Overview: Recombinant Human ICT1 protein(Q14197)(30-206aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 30-206aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.4 kDa
• AA Sequence: LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ICT1 immature colon carcinoma transcript 1 [ Homo sapiens ]
• Official Symbol: ICT1
• Synonyms: ICT1; immature colon carcinoma transcript 1; peptidyl-tRNA hydrolase ICT1, mitochondrial; DS 1; digestion substraction 1; immature colon carcinoma transcript 1 protein; DS1; DS-1
• Gene ID: 3396
• mRNA Refseq: NM_001545
• Protein Refseq: NP_001536
• MIM: 603000
• UniProt ID: Q14197