Recombinant Human IARS protein, His&Myc-tagged

• Cat.No.: IARS-4313H
• Product Overview: Recombinant Human IARS protein(P41252)(693-852aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 693-852aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.3 kDa
• AA Sequence: DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IARS isoleucyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: IARS
• Synonyms: IARS; isoleucyl-tRNA synthetase; isoleucine--tRNA ligase, cytoplasmic; IARS1; ILRS; isoleucine tRNA ligase 1; cytoplasmic; isoleucine tRNA ligase 1, cytoplasmic; isoleucyl-tRNA synthetase, cytoplasmic; IRS; ILERS; PRO0785; FLJ20736
• Gene ID: 3376
• mRNA Refseq: NM_002161
• Protein Refseq: NP_002152
• MIM: 600709
• UniProt ID: P41252