Recombinant Human IARS protein, His&Myc-tagged
Cat.No. : | IARS-4313H |
Product Overview : | Recombinant Human IARS protein(P41252)(693-852aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 693-852aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | IARS isoleucyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | IARS |
Synonyms | IARS; isoleucyl-tRNA synthetase; isoleucine--tRNA ligase, cytoplasmic; IARS1; ILRS; isoleucine tRNA ligase 1; cytoplasmic; isoleucine tRNA ligase 1, cytoplasmic; isoleucyl-tRNA synthetase, cytoplasmic; IRS; ILERS; PRO0785; FLJ20736; |
Gene ID | 3376 |
mRNA Refseq | NM_002161 |
Protein Refseq | NP_002152 |
MIM | 600709 |
UniProt ID | P41252 |
◆ Recombinant Proteins | ||
IARS-8217H | Recombinant Human IARS protein, His & T7-tagged | +Inquiry |
IARS-4398M | Recombinant Mouse IARS Protein, His (Fc)-Avi-tagged | +Inquiry |
IARS-2929H | Recombinant Human IARS protein, His-tagged | +Inquiry |
IARS-4313H | Recombinant Human IARS protein, His&Myc-tagged | +Inquiry |
IARS-7964M | Recombinant Mouse IARS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IARS-5318HCL | Recombinant Human IARS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IARS Products
Required fields are marked with *
My Review for All IARS Products
Required fields are marked with *
0
Inquiry Basket