Recombinant Human HUWE1 protein(4005-4374aa), His&Myc-tagged

• Cat.No.: HUWE1-4016H
• Product Overview: Recombinant Human HUWE1 protein(Q7Z6Z7)(4005-4374aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 4005-4374aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.7 kDa
• AASequence: LERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: HUWE1 HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase [ Homo sapiens ]
• Official Symbol: HUWE1
• Synonyms: HUWE1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain containing 1; E3 ubiquitin-protein ligase HUWE1; Ib772; KIAA0312; UREB1; ARF-binding protein 1; URE-binding protein 1; BJ-HCC-24 tumor antigen; large structure of UREB1; HECT domain protein LASU1; Mcl-1 ubiquitin ligase E3; upstream regulatory element-binding protein 1; homologous to E6AP carboxyl terminus homologous protein 9; MULE; LASU1; HECTH9; URE-B1; ARF-BP1; HSPC272
• Gene ID: 10075
• mRNA Refseq: NM_031407
• Protein Refseq: NP_113584
• MIM: 300697
• UniProt ID: Q7Z6Z7