Recombinant Human HTR3B Protein

• Cat.No.: HTR3B-5239H
• Product Overview: Human HTR3B full-length ORF (NP_006019.1) recombinant protein without tag.

Specification

• Description: The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Form: Liquid
• Molecular Mass: 50.3 kDa
• AA Sequence: MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: HTR3B 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic [ Homo sapiens ]
• Official Symbol: HTR3B
• Synonyms: HTR3B; 5-hydroxytryptamine (serotonin) receptor 3B, ionotropic; 5 hydroxytryptamine (serotonin) receptor 3B; 5-hydroxytryptamine receptor 3B; 5 HT3B; 5-HT3-B; serotonin-gated ion channel subunit; 5-hydroxytryptamine 3 receptor B subunit; 5-HT3B
• Gene ID: 9177
• mRNA Refseq: NM_006028
• Protein Refseq: NP_006019
• MIM: 604654
• UniProt ID: O95264