Recombinant Human HTN3 Protein, GST-tagged

• Cat.No.: HTN3-5252H
• Product Overview: Human HTN3 full-length ORF ( AAH09791, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the histatin family of small, histidine-rich salivary proteins. Histatins exhibit non-immunological, anti-microbial activity in the oral cavity. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.35 kDa
• AA Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTN3 histatin 3 [ Homo sapiens ]
• Official Symbol: HTN3
• Synonyms: HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5
• Gene ID: 3347
• mRNA Refseq: NM_000200
• Protein Refseq: NP_000191
• MIM: 142702
• UniProt ID: P15516