Recombinant Human HTN3 Protein, GST-tagged

• Cat.No.: HTN3-203H
• Product Overview: Recombinant Human HTN3 fused with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Description: This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing.
• Form: Supplied as a 0.2 µM filtered solution of 20mM Tris, 200mM NaCl, pH 8.5
• Molecular Mass: 31.4kD
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFHEKHHS
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: HTN3 histatin 3 [ Homo sapiens ]
• Official Symbol: HTN3
• Synonyms: HTN3; histatin 3; histatin-3; HIS2; PB; hst; histatin 5; histidine-rich protein 3; basic histidine-rich protein; HTN2; HTN5
• Gene ID: 3347
• mRNA Refseq: NM_000200
• Protein Refseq: NP_000191
• MIM: 142702
• UniProt ID: P15516