Recombinant Human HTN1 Protein, GST-tagged

• Cat.No.: HTN1-5253H
• Product Overview: Human HTN1 full-length ORF (AAH17835.1, 1 a.a. - 57 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Aug 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.4 kDa
• AA Sequence: MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HTN1 histatin 1 [ Homo sapiens ]
• Official Symbol: HTN1
• Synonyms: HTN1; histatin 1; histatin-1; HIS1; PPB; post-PB protein; histidine-rich protein 1
• Gene ID: 3346
• mRNA Refseq: NM_002159
• Protein Refseq: NP_002150
• MIM: 142701
• UniProt ID: P15515