Recombinant Full Length Human HTN1 Protein, GST-tagged

Cat.No. : HTN1-5670HF
Product Overview : Human HTN1 full-length ORF (AAH17835.1, 1 a.a. - 57 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 57 amino acids
Description : This gene encodes a member of the histatin family of small, histidine-rich, cationic proteins. They function as antimicrobial peptides and are important components of the innate immune system. Histatins are found in saliva and exhibit antibacterial, antifungal activities and function in wound healing. [provided by RefSeq, Aug 2014]
Molecular Mass : 33.4 kDa
AA Sequence : MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HTN1 histatin 1 [ Homo sapiens ]
Official Symbol HTN1
Synonyms HTN1; histatin 1; histatin-1; HIS1; PPB; post-PB protein; histidine-rich protein 1;
Gene ID 3346
mRNA Refseq NM_002159
Protein Refseq NP_002150
MIM 142701
UniProt ID P15515

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HTN1 Products

Required fields are marked with *

My Review for All HTN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon