Recombinant Human HSPB6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HSPB6-4694H
Product Overview : HSPB6 MS Standard C13 and N15-labeled recombinant protein (NP_653218) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 17.2 kDa
AA Sequence : MEIPVPVQPSWLRRASAPLLGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HSPB6 heat shock protein family B (small) member 6 [ Homo sapiens (human) ]
Official Symbol HSPB6
Synonyms HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20;
Gene ID 126393
mRNA Refseq NM_144617
Protein Refseq NP_653218
MIM 610695
UniProt ID O14558

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSPB6 Products

Required fields are marked with *

My Review for All HSPB6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon