Recombinant Human HSPB6 Protein

• Cat.No.: HSPB6-044H
• Product Overview: Recombinant human HSPB6 protein without tag was expressed in E. coli.

Specification

• Description: This locus encodes a heat shock protein. The encoded protein likely plays a role in smooth muscle relaxation.
• Source: E. coli
• Species: Human
• Form: Lyophilized
• Molecular Mass: 20 kDa
• Protein length: 172
• AA Sequence: MALWPVDRFERMMMEDPMRAMDRFGRMGDMDHWMSRRMMPYWRDADHSMLHVGNQKEVINDDKKFAVSLDVKHFKPNELKVQLDDRDLTVEGMQEVKTEHGYIKKQFVHRWSLPEDCDLDAVHTELDNHGHLSIEAPEDGPSQKFQSSAHSSSAEEEEVGDIEPVNKRILYK
• Purity: > 95%
• Applications: WB
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: Tris-acetate (pH 7.6). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: HSPB6 heat shock protein, alpha-crystallin-related, B6 [ Homo sapiens (human) ]
• Official Symbol: HSPB6
• Synonyms: HSPB6; heat shock protein, alpha-crystallin-related, B6; heat shock protein beta-6; FLJ32389; Hsp20; heat shock 20 kDa-like protein p20
• Gene ID: 126393
• mRNA Refseq: NM_144617
• Protein Refseq: NP_653218
• MIM: 610695
• UniProt ID: O14558