Recombinant Human HSPA4 Protein, GST-tagged

• Cat.No.: HSPA4-5106H
• Product Overview: Human HSPA4 full-length ORF ( AAH02526, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HSPA4 (Heat Shock Protein Family A (Hsp70) Member 4) is a Protein Coding gene. Diseases associated with HSPA4 include Ischemia and Salpingitis Isthmica Nodosa. Among its related pathways are CCR5 Pathway in Macrophages and Validated targets of C-MYC transcriptional activation. An important paralog of this gene is HSPA4L.
• Molecular Mass: 42.02 kDa
• AA Sequence: MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSPA4 heat shock 70kDa protein 4 [ Homo sapiens ]
• Official Symbol: HSPA4
• Synonyms: HSPA4; heat shock 70kDa protein 4; heat shock 70kD protein 4; heat shock 70 kDa protein 4; HS24/P52; hsp70 RY; HSPH2; heat shock protein, 110 kDa; heat shock 70-related protein APG-2; RY; APG-2; hsp70; hsp70RY; MGC131852
• Gene ID: 3308
• mRNA Refseq: NM_002154
• Protein Refseq: NP_002145
• MIM: 601113
• UniProt ID: P34932