Recombinant Human HSD17B3 Protein, GST-tagged

• Cat.No.: HSD17B3-5070H
• Product Overview: Human HSD17B3 full-length ORF ( NP_000188.1, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq
• Molecular Mass: 60.9 kDa
• AA Sequence: MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSD17B3 hydroxysteroid (17-beta) dehydrogenase 3 [ Homo sapiens ]
• Official Symbol: HSD17B3
• Synonyms: HSD17B3; hydroxysteroid (17-beta) dehydrogenase 3; testosterone 17-beta-dehydrogenase 3; SDR12C2; short chain dehydrogenase/reductase family 12C; member 2; 17-beta-HSD3; 17-beta-HSD 3; 17-beta-hydroxysteroid dehydrogenase type 3; testicular 17-beta-hydroxysteroid dehydrogenase; short chain dehydrogenase/reductase family 12C, member 2; EDH17B3
• Gene ID: 3293
• mRNA Refseq: NM_000197
• Protein Refseq: NP_000188
• MIM: 605573
• UniProt ID: P37058