Recombinant Human HSD11B1 protein, His-SUMO-tagged

Cat.No. : HSD11B1-3054H
Product Overview : Recombinant Human HSD11B1 protein(P28845)(25-292aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 25-292aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 45.5 kDa
AA Sequence : EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ]
Official Symbol HSD11B1
Synonyms HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539;
Gene ID 3290
mRNA Refseq NM_001206741
Protein Refseq NP_001193670
MIM 600713
UniProt ID P28845

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HSD11B1 Products

Required fields are marked with *

My Review for All HSD11B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon