Recombinant Human HSD11B1 protein, His-SUMO-tagged

• Cat.No.: HSD11B1-3054H
• Product Overview: Recombinant Human HSD11B1 protein(P28845)(25-292aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 25-292aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.5 kDa
• AA Sequence: EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ]
• Official Symbol: HSD11B1
• Synonyms: HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539
• Gene ID: 3290
• mRNA Refseq: NM_001206741
• Protein Refseq: NP_001193670
• MIM: 600713
• UniProt ID: P28845