Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HS1BP3-6446H |
Product Overview : | HS1BP3 MS Standard C13 and N15-labeled recombinant protein (NP_071905) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSMDPLKLFDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEAVAGQQKPQEQIQAMDEMDILQYIQDHDTPAQATPSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HS1BP3 HCLS1 binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | HS1BP3 |
Synonyms | HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3; |
Gene ID | 64342 |
mRNA Refseq | NM_022460 |
Protein Refseq | NP_071905 |
MIM | 609359 |
UniProt ID | Q53T59 |
◆ Recombinant Proteins | ||
HS1BP3-5046H | Recombinant Human HS1BP3 Protein, GST-tagged | +Inquiry |
HS1BP3-6446H | Recombinant Human HS1BP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HS1BP3-8133Z | Recombinant Zebrafish HS1BP3 | +Inquiry |
HS1BP3-7854M | Recombinant Mouse HS1BP3 Protein | +Inquiry |
HS1BP3-3690HF | Recombinant Full Length Human HS1BP3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HS1BP3-5389HCL | Recombinant Human HS1BP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HS1BP3 Products
Required fields are marked with *
My Review for All HS1BP3 Products
Required fields are marked with *
0
Inquiry Basket