Recombinant Human HS1BP3 Protein, GST-tagged

• Cat.No.: HS1BP3-5046H
• Product Overview: Human HS1BP3 full-length ORF ( AAH27947, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 49.17 kDa
• AA Sequence: MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPEDVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRLVSCC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HS1BP3 HCLS1 binding protein 3 [ Homo sapiens ]
• Official Symbol: HS1BP3
• Synonyms: HS1BP3; HCLS1 binding protein 3; HCLS1-binding protein 3; HS1 BP3; FLJ14249; HSP1BP-3; HS1-binding protein 3; ETM2; HS1-BP3
• Gene ID: 64342
• mRNA Refseq: NM_022460
• Protein Refseq: NP_071905
• MIM: 609359
• UniProt ID: Q53T59