Recombinant Human HRH4 Protein, GST-tagged

Description :	Histamine is a ubiquitous messenger molecule released from mast cells, enterochromaffin-like cells, and neurons. Its various actions are mediated by a family of histamine receptors, which are a subset of the G-protein coupled receptor superfamily. This gene encodes a histamine receptor that is predominantly expressed in haematopoietic cells. The protein is thought to play a role in inflammation and allergy reponses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	37.95 kDa
AA Sequence :	NMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSASTEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARRLAKS
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	HRH4 histamine receptor H4 [ Homo sapiens ]
Official Symbol	HRH4
Synonyms	HRH4; histamine receptor H4; histamine H4 receptor; AXOR35; GPCR105; GPRv53; H4R; HH4R; SP9144; pfi-013; G-protein coupled receptor 105; H4; BG26; MGC133027;
Gene ID	59340
mRNA Refseq	NM_001143828
Protein Refseq	NP_001137300
MIM	606792
UniProt ID	Q9H3N8