Recombinant Human HRASLS5 Protein, GST-tagged

• Cat.No.: HRASLS5-5028H
• Product Overview: Human HRASLS5 full-length ORF ( AAH34222.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HRASLS5 (HRAS Like Suppressor Family Member 5) is a Protein Coding gene. Diseases associated with HRASLS5 include Poland Syndrome and Myasthenic Syndrome, Congenital, 5. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups. An important paralog of this gene is RARRES3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 55.7 kDa
• AA Sequence: MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HRASLS5 HRAS-like suppressor family, member 5 [ Homo sapiens ]
• Official Symbol: HRASLS5
• Synonyms: HRASLS5; HRAS-like suppressor family, member 5; HRAS-like suppressor 5; HRLP5; H-rev107-like protein 5; lecithin-retinol acyltransferase (LRAT)-like protein-1; calcium-independent phosphatidylethanolamine N-acyltransferase; RLP1; iNAT
• Gene ID: 117245
• mRNA Refseq: NM_001146728
• Protein Refseq: NP_001140200
• MIM: 611474
• UniProt ID: Q96KN8