Recombinant Full Length Human HRASLS5 Protein, GST-tagged

Cat.No. : HRASLS5-3653HF
Product Overview : Human HRASLS5 full-length ORF ( AAH34222.1, 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 269 amino acids
Description : HRASLS5 (HRAS Like Suppressor Family Member 5) is a Protein Coding gene. Diseases associated with HRASLS5 include Poland Syndrome and Myasthenic Syndrome, Congenital, 5. Among its related pathways are Acyl chain remodelling of PE and Glycerophospholipid biosynthesis. GO annotations related to this gene include transferase activity, transferring acyl groups. An important paralog of this gene is RARRES3.
Molecular Mass : 55.7 kDa
AA Sequence : MGLSPGAEGEYALRLPRIPPPLPKPASRTAGTGPKDQPPALRRSAVPHSEESVGFAALVQLPAKQPPPGTLEQGRSIQQGEKAVVSLETTPSQKADWSSIPKPENEGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSITSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKIVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HRASLS5 HRAS-like suppressor family, member 5 [ Homo sapiens ]
Official Symbol HRASLS5
Synonyms HRASLS5; HRAS-like suppressor family, member 5; HRAS-like suppressor 5; HRLP5; H-rev107-like protein 5; lecithin-retinol acyltransferase (LRAT)-like protein-1; calcium-independent phosphatidylethanolamine N-acyltransferase; RLP1; iNAT;
Gene ID 117245
mRNA Refseq NM_001146728
Protein Refseq NP_001140200
MIM 611474
UniProt ID Q96KN8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HRASLS5 Products

Required fields are marked with *

My Review for All HRASLS5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon