Recombinant Human HP Protein, His-tagged

• Cat.No.: HP-715H
• Product Overview: Recombinant Human HP, transcript variant 1, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Description: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin, which allows degradative enzymes to gain access to the hemoglobin, while at the same time preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin. Mutations in this gene and/or its regulatory regions cause ahaptoglobinemia or hypohaptoglobinemia. This gene has also been linked to diabetic nephropathy, the incidence of coronary artery disease in type 1 diabetes, Crohn's disease, inflammatory disease behavior, primary sclerosing cholangitis, susceptibility to idiopathic Parkinson's disease, and a reduced incidence of Plasmodium falciparum malaria. The protein encoded also exhibits antimicrobial activity against bacteria. A similar duplicated gene is located next to this gene on chromosome 16. Multiple transcript variants encoding different isoforms have been found for this gene.
• Source: HEK293 cells
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.2
• Molecular Mass: 44.4kD
• AA Sequence: VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAENVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: HP haptoglobin [ Homo sapiens ]
• Official Symbol: HP
• Synonyms: HP; haptoglobin; zonulin; binding peptide; haptoglobin alpha(1S)-beta; haptoglobin alpha(2FS)-beta; haptoglobin, beta polypeptide; haptoglobin, alpha polypeptide; BP; HPA1S; HP2ALPHA2; MGC111141
• Gene ID: 3240
• mRNA Refseq: NM_001126102
• Protein Refseq: NP_001119574
• MIM: 140100
• UniProt ID: P00738