Recombinant Human HOXD1

• Cat.No.: HOXD1-26895TH
• Product Overview: Recombinant fragment of Human HOXD1 with N terminal proprietary tag. Predicted MW 35.53 kDa.

Specification

• Description: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. This nuclear protein functions as a sequence-specific transcription factor that is involved in differentiation and limb development. Mutations in this gene have been associated with severe developmental defects on the anterior-posterior (a-p) limb axis.
• Protein length: 90 amino acids
• Molecular Weight: 35.530kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ
• Sequence Similarities: Belongs to the Antp homeobox family. Labial subfamily.Contains 1 homeobox DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: HOXD1 homeobox D1 [ Homo sapiens ]
• Official Symbol: HOXD1
• Synonyms: HOXD1; homeobox D1; homeo box D1 , HOX4, HOX4G; homeobox protein Hox-D1
• Gene ID: 3231
• mRNA Refseq: NM_024501
• Protein Refseq: NP_078777
• MIM: 142987
• Uniprot ID: Q9GZZ0
• Chromosome Location: 2q31.1
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity