Recombinant Human HOXB9 Protein, GST-tagged

Cat.No. : HOXB9-4970H
Product Overview : Human HOXB9 full-length ORF ( NP_076922.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq
Molecular Mass : 54.5 kDa
AA Sequence : MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXB9 homeobox B9 [ Homo sapiens ]
Official Symbol HOXB9
Synonyms HOXB9; homeobox B9; homeo box B9 , HOX2, HOX2E; homeobox protein Hox-B9; homeo box 2E; homeo box B9; homeobox protein Hox-2E; homeobox protein Hox-2.5; HOX2; HOX2E; HOX-2.5;
Gene ID 3219
mRNA Refseq NM_024017
Protein Refseq NP_076922
MIM 142964
UniProt ID P17482

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HOXB9 Products

Required fields are marked with *

My Review for All HOXB9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon