Recombinant Full Length Human HOXB9 Protein, GST-tagged

• Cat.No.: HOXB9-3722HF
• Product Overview: Human HOXB9 full-length ORF ( NP_076922.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 250 amino acids
• Description: This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq
• Molecular Mass: 54.5 kDa
• AA Sequence: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXB9 homeobox B9 [ Homo sapiens ]
• Official Symbol: HOXB9
• Synonyms: HOXB9; homeobox B9; homeo box B9 , HOX2, HOX2E; homeobox protein Hox-B9; homeo box 2E; homeo box B9; homeobox protein Hox-2E; homeobox protein Hox-2.5; HOX2; HOX2E; HOX-2.5
• Gene ID: 3219
• mRNA Refseq: NM_024017
• Protein Refseq: NP_076922
• MIM: 142964
• UniProt ID: P17482