Recombinant Human HOXA3 Protein, GST-tagged

• Cat.No.: HOXA3-4944H
• Product Overview: Human HOXA3 partial ORF ( NP_705895, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 34.21 kDa
• AA Sequence: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGGHPKAHELSEACLRTLSA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA3 homeobox A3 [ Homo sapiens ]
• Official Symbol: HOXA3
• Synonyms: HOXA3; homeobox A3; homeo box A3 , HOX1, HOX1E; homeobox protein Hox-A3; homeo box 1E; homeo box A3; Hox-1.5-like protein; homeobox protein Hox-1E; HOX1; HOX1E; MGC10155
• Gene ID: 3200
• mRNA Refseq: NM_030661
• Protein Refseq: NP_109377
• MIM: 142954
• UniProt ID: O43365