Recombinant Human HOXA13 Protein, GST-tagged

• Cat.No.: HOXA13-4942H
• Product Overview: Human HOXA13 partial ORF ( NP_000513, 208 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXA13 homeobox A13 [ Homo sapiens ]
• Official Symbol: HOXA13
• Synonyms: HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13; homeo box 1J; homeo box A13; homeobox protein HOXA13; homeobox protein Hox-1J; transcription factor HOXA13; HOX1; HOX1J
• Gene ID: 3209
• mRNA Refseq: NM_000522
• Protein Refseq: NP_000513
• MIM: 142959
• UniProt ID: P31271