Recombinant Human HOXA13 Protein, GST-tagged
Cat.No. : | HOXA13-4942H |
Product Overview : | Human HOXA13 partial ORF ( NP_000513, 208 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HOXA13 homeobox A13 [ Homo sapiens ] |
Official Symbol | HOXA13 |
Synonyms | HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13; homeo box 1J; homeo box A13; homeobox protein HOXA13; homeobox protein Hox-1J; transcription factor HOXA13; HOX1; HOX1J; |
Gene ID | 3209 |
mRNA Refseq | NM_000522 |
Protein Refseq | NP_000513 |
MIM | 142959 |
UniProt ID | P31271 |
◆ Recombinant Proteins | ||
HOXA13-01H | Recombinant Human HOXA13 Protein, N-His tagged | +Inquiry |
HOXA13-5715C | Recombinant Chicken HOXA13 | +Inquiry |
HOXA13-7787M | Recombinant Mouse HOXA13 Protein | +Inquiry |
HOXA13-4942H | Recombinant Human HOXA13 Protein, GST-tagged | +Inquiry |
HOXA13-4277M | Recombinant Mouse HOXA13 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HOXA13 Products
Required fields are marked with *
My Review for All HOXA13 Products
Required fields are marked with *
0
Inquiry Basket