Recombinant Human HOXA13

• Cat.No.: HOXA13-28510TH
• Product Overview: Recombinant fragment corresponding to amino acids 208-306 of Human HOXA13 with a N terminal proprietary tag; predicted MWt 36.52 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 99 amino acids
• Description: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Expansion of a polyalanine tract in the encoded protein can cause hand-foot-uterus syndrome, also known as hand-foot-genital syndrome.
• Molecular Weight: 36.520kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTL
• Sequence Similarities: Belongs to the Abd-B homeobox family.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: HOXA13 homeobox A13 [ Homo sapiens ]
• Official Symbol: HOXA13
• Synonyms: HOXA13; homeobox A13; homeo box A13 , HOX1, HOX1J; homeobox protein Hox-A13
• Gene ID: 3209
• mRNA Refseq: NM_000522
• Protein Refseq: NP_000513
• MIM: 142959
• Uniprot ID: P31271
• Chromosome Location: 7p15.2
• Function: DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding