Recombinant Human HNRNPL Protein (89-335 aa), His-tagged

Cat.No. : HNRNPL-1414H
Product Overview : Recombinant Human HNRNPL Protein (89-335 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 89-335 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 29.0 kDa
AA Sequence : IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ]
Official Symbol HNRNPL
Synonyms HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509;
Gene ID 3191
mRNA Refseq NM_001005335
Protein Refseq NP_001005335
MIM 603083
UniProt ID Q6NTA2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNRNPL Products

Required fields are marked with *

My Review for All HNRNPL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon