Recombinant Human HNRNPL Protein (89-335 aa), His-tagged

• Cat.No.: HNRNPL-1414H
• Product Overview: Recombinant Human HNRNPL Protein (89-335 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 29.0 kDa
• Protein length: 89-335 aa
• AA Sequence: IRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGH
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: HNRNPL heterogeneous nuclear ribonucleoprotein L [ Homo sapiens ]
• Official Symbol: HNRNPL
• Synonyms: HNRNPL; HNRPL; hnRNP L; hnRNP-L; P/OKcl.14; FLJ35509
• Gene ID: 3191
• mRNA Refseq: NM_001005335
• Protein Refseq: NP_001005335
• MIM: 603083
• UniProt ID: Q6NTA2