Recombinant Human HNF4G protein, GST-tagged

• Cat.No.: HNF4G-301151H
• Product Overview: Recombinant Human HNF4G (327-408 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Gly327-Leu408
• AA Sequence: GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ]
• Official Symbol: HNF4G
• Synonyms: HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2; HNF-4-gamma; nuclear receptor subfamily 2 group A member 2; NR2A3
• Gene ID: 3174
• mRNA Refseq: NM_004133
• Protein Refseq: NP_004124
• MIM: 605966
• UniProt ID: Q14541