Recombinant Human HNF4G

• Cat.No.: HNF4G-29372TH
• Product Overview: Recombinant fragment of Human HNF4 gamma with N terminal proprietary tag; Predicted MW 36.41 kDa.

Specification

• Protein length: 98 amino acids
• Molecular Weight: 36.410kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
• Sequence Similarities: Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: HNF4G hepatocyte nuclear factor 4, gamma [ Homo sapiens ]
• Official Symbol: HNF4G
• Synonyms: HNF4G; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; NR2A2
• Gene ID: 3174
• mRNA Refseq: NM_004133
• Protein Refseq: NP_004124
• MIM: 605966
• Uniprot ID: Q14541
• Chromosome Location: 8q21-q22
• Pathway: Developmental Biology, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem
• Function: metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity