Recombinant Human HNF4A
Cat.No. : | HNF4A-28507TH |
Product Overview : | Recombinant fragment of Human HNF4 (amino acids 324-423) with N terminal proprietary tag, 36.63kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP |
Sequence Similarities : | Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain. |
Gene Name | HNF4A hepatocyte nuclear factor 4, alpha [ Homo sapiens ] |
Official Symbol | HNF4A |
Synonyms | HNF4A; hepatocyte nuclear factor 4, alpha; MODY, MODY1, TCF14; hepatocyte nuclear factor 4-alpha; HNF4; NR2A1; |
Gene ID | 3172 |
mRNA Refseq | NM_000457 |
Protein Refseq | NP_000448 |
MIM | 600281 |
Uniprot ID | P41235 |
Chromosome Location | 20q13.12 |
Pathway | Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; |
Function | DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; activating transcription factor binding; fatty acid binding; fatty-acyl-CoA binding; |
◆ Recombinant Proteins | ||
HNF4A-790H | Recombinant Human HNF4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNF4A-1084H | Recombinant Human HNF4A Protein, His (Fc)-Avi-tagged | +Inquiry |
HNF4A-3042H | Recombinant Human HNF4A protein, His&Myc-tagged | +Inquiry |
HNF4A-2893H | Recombinant Human HNF4A protein, His-tagged | +Inquiry |
HNF4A-4255M | Recombinant Mouse HNF4A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF4A-5459HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5457HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5456HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5458HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNF4A Products
Required fields are marked with *
My Review for All HNF4A Products
Required fields are marked with *
0
Inquiry Basket