Recombinant Human HNF4A

Cat.No. : HNF4A-28507TH
Product Overview : Recombinant fragment of Human HNF4 (amino acids 324-423) with N terminal proprietary tag, 36.63kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Sequence Similarities : Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name HNF4A hepatocyte nuclear factor 4, alpha [ Homo sapiens ]
Official Symbol HNF4A
Synonyms HNF4A; hepatocyte nuclear factor 4, alpha; MODY, MODY1, TCF14; hepatocyte nuclear factor 4-alpha; HNF4; NR2A1;
Gene ID 3172
mRNA Refseq NM_000457
Protein Refseq NP_000448
MIM 600281
Uniprot ID P41235
Chromosome Location 20q13.12
Pathway Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem;
Function DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; activating transcription factor binding; fatty acid binding; fatty-acyl-CoA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HNF4A Products

Required fields are marked with *

My Review for All HNF4A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon