Recombinant Human HNF4A

• Cat.No.: HNF4A-28507TH
• Product Overview: Recombinant fragment of Human HNF4 (amino acids 324-423) with N terminal proprietary tag, 36.63kDa inclusive of tag.

Specification

• Description: The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
• Sequence Similarities: Belongs to the nuclear hormone receptor family. NR2 subfamily.Contains 1 nuclear receptor DNA-binding domain.
• Tag: Non

Gene Information

• Gene Name: HNF4A hepatocyte nuclear factor 4, alpha [ Homo sapiens ]
• Official Symbol: HNF4A
• Synonyms: HNF4A; hepatocyte nuclear factor 4, alpha; MODY, MODY1, TCF14; hepatocyte nuclear factor 4-alpha; HNF4; NR2A1
• Gene ID: 3172
• mRNA Refseq: NM_000457
• Protein Refseq: NP_000448
• MIM: 600281
• Uniprot ID: P41235
• Chromosome Location: 20q13.12
• Pathway: Developmental Biology, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem
• Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; activating transcription factor binding; fatty acid binding; fatty-acyl-CoA binding