Recombinant Human HMP19 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HMP19-3301H
• Product Overview: HMP19 MS Standard C13 and N15-labeled recombinant protein (NP_057064) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: NSG2 (Neuronal Vesicle Trafficking Associated 2) is a Protein Coding gene. Diseases associated with NSG2 include Nipah Virus Encephalitis. An important paralog of this gene is NSG1.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 19.1 kDa
• AA Sequence: MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HMP19 HMP19 protein [ Homo sapiens (human) ]
• Official Symbol: HMP19
• Synonyms: HMP19; HMP19 protein; neuron-specific protein family member 2; NSG2; p19 protein; protein p19; hypothalamus golgi apparatus expressed 19 kDa protein
• Gene ID: 51617
• mRNA Refseq: NM_015980
• Protein Refseq: NP_057064
• MIM: 616752
• UniProt ID: Q9Y328