Recombinant Human HMP19 Protein, GST-tagged

• Cat.No.: HMP19-4887H
• Product Overview: Human HMP19 full-length ORF ( AAH02619, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HMP19 (HMP19 Protein) is a Protein Coding gene. GO annotations related to this gene include clathrin light chain binding. An important paralog of this gene is NSG1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.55 kDa
• AA Sequence: MVKLNSNPSEKGTKPPSVEDGFQTVPLITPLEVNHLQLPAPEKVIVKTRTEYQPEQKNKGKFRVPKIAEFTVTILVSLALAFLACIVFLVVYKAFTYDHSCPEGFVYKHKRCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMP19 HMP19 protein [ Homo sapiens ]
• Official Symbol: HMP19
• Synonyms: HMP19; HMP19 protein; neuron-specific protein family member 2; NSG2; p19 protein; protein p19; hypothalamus golgi apparatus expressed 19 kDa protein
• Gene ID: 51617
• mRNA Refseq: NM_015980
• Protein Refseq: NP_057064