Recombinant Human HMOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HMOX1-5723H
• Product Overview: HMOX1 MS Standard C13 and N15-labeled recombinant protein (NP_002124) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 32.8 kDa
• AA Sequence: MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQHYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HMOX1 heme oxygenase 1 [ Homo sapiens (human) ]
• Official Symbol: HMOX1
• Synonyms: HMOX1; heme oxygenase (decycling) 1; heme oxygenase 1; bK286B10; HO 1; heat shock protein, 32-kD; HO-1; HSP32
• Gene ID: 3162
• mRNA Refseq: NM_002133
• Protein Refseq: NP_002124
• MIM: 141250
• UniProt ID: P09601