Recombinant Human HMGB1, StrepII-tagged

• Cat.No.: HMGB1-255H
• Product Overview: Purified, full-length human recombinant HMGB1 or High mobility group protein B1 protein (amino acids 2-215, 214 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 24.8 kDa. (Accession NP_002119.1; UniProt P09429)

Specification

• Product Overview: Purified, full-length human recombinant HMGB1 or High mobility group protein B1 protein (amino acids 2-215, 214 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 24.8 kDa. (Accession NP_002119.1; UniProt P09429)
• Description: HMGB1 is a DNA binding protein that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 2-215, 214 a.a.
• AA Sequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKD PNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEE DEEDEEEEEDEEDEDEEEDDDDE
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: HMGB1 high mobility group box 1 [ Homo sapiens ]
• Official Symbol: HMGB1
• Synonyms: HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1
• Gene ID: 3146
• mRNA Refseq: NM_002128
• Protein Refseq: NP_002119
• MIM: 163905
• UniProt ID: P09429
• Chromosome Location: 13q12
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Activation of DNA fragmentation factor, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis induced DNA fragmentation, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem
• Function: DNA binding; DNA binding, bending; DNA binding, bending; RAGE receptor binding; calcium-dependent protein kinase regulator activity; chemoattractant activity; cytokine activity; cytokine activity; damaged DNA binding; double-stranded DNA binding; protein binding; protein kinase activator activity; repressing transcription factor binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding; transcription factor binding