Recombinant Human HMGB1, StrepII-tagged
Cat.No. : | HMGB1-255H |
Product Overview : | Purified, full-length human recombinant HMGB1 or High mobility group protein B1 protein (amino acids 2-215, 214 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 24.8 kDa. (Accession NP_002119.1; UniProt P09429) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 2-215, 214 a.a. |
Description : | HMGB1 is a DNA binding protein that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKD PNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEE DEEDEEEEEDEEDEDEEEDDDDE |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | HMGB1 high mobility group box 1 [ Homo sapiens ] |
Official Symbol | HMGB1 |
Synonyms | HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1; |
Gene ID | 3146 |
mRNA Refseq | NM_002128 |
Protein Refseq | NP_002119 |
MIM | 163905 |
UniProt ID | P09429 |
Chromosome Location | 13q12 |
Pathway | Activated TLR4 signalling, organism-specific biosystem; Activation of DNA fragmentation factor, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis induced DNA fragmentation, organism-specific biosystem; Apoptotic executionphase, organism-specific biosystem; |
Function | DNA binding; DNA binding, bending; DNA binding, bending; RAGE receptor binding; calcium-dependent protein kinase regulator activity; chemoattractant activity; cytokine activity; cytokine activity; damaged DNA binding; double-stranded DNA binding; protein binding; protein kinase activator activity; repressing transcription factor binding; sequence-specific DNA binding transcription factor activity; single-stranded DNA binding; transcription factor binding; |
◆ Recombinant Proteins | ||
HMGB1-8460H | Active Recombinant Human HMGB1, His-tagged | +Inquiry |
Hmgb1-2628M | Active Recombinant Mouse Hmgb1 protein, His-tagged | +Inquiry |
Hmgb1-2629M | Recombinant Mouse Hmgb1 protein, His-tagged | +Inquiry |
HMGB1-1079H | Recombinant Human HMGB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGB1-3077H | Recombinant Human HMGB1 Protein (Met1-Glu215), N-His tagged | +Inquiry |
◆ Native Proteins | ||
HMGB1-8447B | Active Native Bovine HMGB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB1-2076HCL | Recombinant Human HMGB1 cell lysate | +Inquiry |
HMGB1-1677MCL | Recombinant Mouse HMGB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMGB1 Products
Required fields are marked with *
My Review for All HMGB1 Products
Required fields are marked with *
0
Inquiry Basket