Recombinant Human HMGB1 protein, hFc-Flag-Myc-tagged

• Cat.No.: HMGB1-5454H
• Product Overview: Recombinant Human HMGB1 protein(P09429)(2-215aa), fused with N-terminal hFc and Flag and Myc tag, was expressed in HEK293.

Specification

• Product Overview: Recombinant Human HMGB1 protein(P09429)(2-215aa), fused with N-terminal hFc and Flag and Myc tag, was expressed in HEK293.
• Source: HEK293
• Species: Human
• Tag: N-hFc-Flag-Myc
• Protein length: 2-215aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.1 kDa
• AASequence: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: HMGB1 high mobility group box 1 [ Homo sapiens ]
• Official Symbol: HMGB1
• Synonyms: HMGB1; high mobility group box 1; high mobility group (nonhistone chromosomal) protein 1 , high mobility group box 1 , HMG1; high mobility group protein B1; Amphoterin; DKFZp686A04236; high mobility group protein 1; HMG3; SBP 1; Sulfoglucuronyl carbohydrate binding protein; HMG-1; high-mobility group box 1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; SBP-1
• Gene ID: 3146
• mRNA Refseq: NM_002128
• Protein Refseq: NP_002119
• MIM: 163905
• UniProt ID: P09429