Recombinant Human HLA-G protein, His-tagged

• Cat.No.: HLA-G-3322H
• Product Overview: Recombinant Human HLA-G protein(P17693)(25-319aa), fused with C-terminal His tag, was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 25-319aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.1 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWSKEGDGGIMSVRESRSLSEDL

Gene Information

• Gene Name: HLA-G major histocompatibility complex, class I, G [ Homo sapiens ]
• Official Symbol: HLA-G
• Synonyms: HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G
• Gene ID: 3135
• mRNA Refseq: NM_002127
• Protein Refseq: NP_002118
• MIM: 142871
• UniProt ID: P17693