Recombinant Human HLA-G Protein
Cat.No. : | HLA-G-1241H |
Product Overview : | Recombinant Human HLA-G Protein (25-338aa) was expressed in mammalian cells with N-terminal His-tag. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 25-338 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens ] |
Official Symbol | HLA-G |
Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G |
Gene ID | 3135 |
mRNA Refseq | NM_002127 |
Protein Refseq | NP_002118 |
MIM | 142871 |
UniProt ID | P17693 |
◆ Recombinant Proteins | ||
HLA-G-27H | Recombinant Human HLA-G protein, GST-tagged | +Inquiry |
HLA-G-312H | Recombinant Human HLA-G Protein, His-Avi-tagged | +Inquiry |
HLA-G-38H | Recombinant Human HLA-G protein | +Inquiry |
HLA-G-1077H | Recombinant Human HLA-G Protein, His (Fc)-Avi-tagged | +Inquiry |
HLA-G-502H | Recombinant Human HLA-G protein(Gly25-Thr305(C66S)), His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HLA-G-1242H | Recombinant Human HLA-G Protein, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
0
Inquiry Basket