Recombinant Human HLA-G protein

• Cat.No.: HLA-G-39H
• Product Overview: Recombinant Human HLA-G protein (25-338aa) was fused to 6xHis/SUMO-tag at the N-terminus and expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 25-338 a.a.
• Description: HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.
• Form: Liquid or Lyophilized powder. If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.6 kDa
• AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
• Endotoxin: <1.0 EU per 1µg (determined by the LAL method).
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20 centigrade upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Expiry: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20/-80 centigrade. The shelf life of lyophilized form is 12 months at -20/-80 centigrade.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: HLA-G
• Official Symbol: HLA-G
• Synonyms: MHC-G
• Gene ID: 3135
• mRNA Refseq: NM_001363567.1
• Protein Refseq: NP_001350496.1
• MIM: 142871
• UniProt ID: P17693