Recombinant Human HLA-DRB3, GST-tagged

• Cat.No.: HLA-DRB3-1210H
• Product Overview: Recombinant Human HLA-DRB3 encod-ing human HLA-DRB3 full-length ORF (1 a.a. - 266 a.a.) fused with GST-tag at N-terminal was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-266 a.a.
• Description: HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted.
• Molecular Mass: 55 kDa
• Sequence: MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
• Stability: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• OfficialSymbol: HLA-DRB3

Gene Information

• Gene Name: HLA-DRB3 major histocompatibility complex, class II, DR beta 3 [ Homo sapiens ]
• Synonyms: HLA-DR3B; major histocompatibility complex, class II, DR beta 3; DR7; MHC class II antigen DRB3; human leucocyte antigen DRB3; MHC class II HLA-DR beta 3 chain; MHC class II antigen DR beta 3 chain; HLA class II histocompatibility antigen, DR beta 3 chain; HLA class II histocompatibility antigen, DRB1-7 beta chain
• Gene ID: 3125
• mRNA Refseq: NM_022555
• Protein Refseq: NP_072049
• MIM: 612735
• UniProt ID: P13761
• Chromosome Location: 6p21.3
• Pathway: Adaptive Immune System; Allograft rejection; Antigen processing and presentation; Asthma; Autoimmune thyroid disease; Cell adhesion molecules (CAMs)
• Function: MHC class II receptor activity; peptide antigen binding; protein binding; MHC class II receptor activity