Recombinant Human HLA-DRB1 Protein, His-SUMO/MYC-tagged
Cat.No. : | HLA-DRB1-1240H |
Product Overview : | Recombinant Human HLA-DRB1 Protein (30-227aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 30-227 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 42.9 kDa |
AA Sequence : | GDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQ RRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKA GVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
Official Symbol | HLA-DRB1 major histocompatibility complex, class II, DR beta 1 [ Homo sapiens ] |
Synonyms | HLA-DRB1; major histocompatibility complex, class II, DR beta 1; HLA DR1B; DW2.2/DR2.2; MHC class II antigen; lymphocyte antigen DRB1; MHC class II HLA-DRw10-beta; human leucocyte antigen DRB1; MHC class II HLA-DR beta 1 chain; MHC class II HLA-DR-beta cell surface glycoprotein; HLA class II histocompatibility antigen, DR-1 beta chain; SS1; DRB1; DRw10; HLA-DRB; HLA-DR1B; FLJ75017; FLJ76359 |
Gene ID | 3123 |
mRNA Refseq | NM_001243965 |
Protein Refseq | NP_001230894 |
MIM | 142857 |
UniProt ID | P01911 |
◆ Recombinant Proteins | ||
HLA-DRB1-1240H | Recombinant Human HLA-DRB1 Protein, His-SUMO/MYC-tagged | +Inquiry |
HLA-DRB1-13822H | Recombinant Human HLA-DRB1, GST-tagged | +Inquiry |
HLA-DRB1-358M | Recombinant Mouse HLA-DRB1 Protein, His-tagged | +Inquiry |
HLA-DRB1-01H | Recombinant Human HLA-DRB1 protein, His-tagged | +Inquiry |
RFL13855HF | Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Drb1-13 Beta Chain(Hla-Drb1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DRB1-797HCL | Recombinant Human HLA-DRB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DRB1 Products
Required fields are marked with *
My Review for All HLA-DRB1 Products
Required fields are marked with *
0
Inquiry Basket