Recombinant Human HLA-DQA1

• Cat.No.: HLA-DQA1-29328TH
• Product Overview: Recombinant fragment of Human HLA-DQA1 (aa 24-110) with a N terminal proprietary tag: predicted molecular weight 35.20 kDa.

Specification

• Description: HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation.
• Protein length: 87 amino acids
• Molecular Weight: 35.200kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
• Sequence Similarities: Belongs to the MHC class II family.Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
• Tag: Non

Gene Information

• Gene Name: HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens ]
• Official Symbol: HLA-DQA1
• Synonyms: HLA-DQA1; major histocompatibility complex, class II, DQ alpha 1; HLA DQA; HLA class II histocompatibility antigen, DQ alpha 1 chain; CELIAC1
• Gene ID: 3117
• mRNA Refseq: NM_002122
• Protein Refseq: NP_002113
• MIM: 146880
• Uniprot ID: P01909
• Chromosome Location: 6p21.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem
• Function: MHC class II receptor activity; MHC class II receptor activity