Recombinant Full Length Human HLA-DQA1 Protein, C-Flag-tagged
Cat.No. : | HLA-DQA1-973HFL |
Product Overview : | Recombinant Full Length Human HLA-DQA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 27.8 kDa |
AA Sequence : | MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQFTHEFDGDEQFYVDLEKKETAWR WPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLDNIFPP VVNITWLSNGHAVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAP MSELTETVVCALGLSVGLVGIVVGTVFIIQGLRSVGASRHQGPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis |
Full Length : | Full L. |
Gene Name | HLA-DQA1 major histocompatibility complex, class II, DQ alpha 1 [ Homo sapiens (human) ] |
Official Symbol | HLA-DQA1 |
Synonyms | DQA1; DQ-A1; CELIAC1; HLA-DQA; HLA-DQB1; HLA-DQA1* |
Gene ID | 3117 |
mRNA Refseq | NM_002122.5 |
Protein Refseq | NP_002113.2 |
MIM | 146880 |
UniProt ID | P01909 |
◆ Recombinant Proteins | ||
HLA-DQA1-2102R | Recombinant Rhesus monkey HLA-DQA1 Protein, His-tagged | +Inquiry |
HLA-DQA1-13819H | Recombinant Human HLA-DQA1, GST-tagged | +Inquiry |
HLA-DQA1-1923R | Recombinant Rhesus Macaque HLA-DQA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HLA-DQA1-5291H | Recombinant Human HLA-DQA1 protein, His-tagged | +Inquiry |
HLA-DQA1-4844H | Recombinant Human HLA-DQA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQA1-5507HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DQA1 Products
Required fields are marked with *
My Review for All HLA-DQA1 Products
Required fields are marked with *
0
Inquiry Basket