Recombinant Human HLA-DOB Protein, GST-tagged
Cat.No. : | HLA-DOB-4839H |
Product Overview : | Human HLA-DOB partial ORF ( NP_002111, 27 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 35.64 kDa |
AA Sequence : | TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Protein length : | 27-116 a.a. |
Gene Name | HLA-DOB major histocompatibility complex, class II, DO beta [ Homo sapiens ] |
Official Symbol | HLA-DOB |
Synonyms | HLA-DOB; major histocompatibility complex, class II, DO beta; HLA class II histocompatibility antigen, DO beta chain; MHC class II antigen DOB; DOB; FLJ57033; |
Gene ID | 3112 |
mRNA Refseq | NM_002120 |
Protein Refseq | NP_002111 |
MIM | 600629 |
UniProt ID | P13765 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HLA-DOB Products
Required fields are marked with *
My Review for All HLA-DOB Products
Required fields are marked with *
0
Inquiry Basket