Recombinant Human HLA-DOB Protein, GST-tagged

• Cat.No.: HLA-DOB-4839H
• Product Overview: Human HLA-DOB partial ORF ( NP_002111, 27 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: TDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 27-116 a.a.

Gene Information

• Gene Name: HLA-DOB major histocompatibility complex, class II, DO beta [ Homo sapiens ]
• Official Symbol: HLA-DOB
• Synonyms: HLA-DOB; major histocompatibility complex, class II, DO beta; HLA class II histocompatibility antigen, DO beta chain; MHC class II antigen DOB; DOB; FLJ57033
• Gene ID: 3112
• mRNA Refseq: NM_002120
• Protein Refseq: NP_002111
• MIM: 600629
• UniProt ID: P13765