Recombinant Human HLA-DMB protein, His-tagged

• Cat.No.: HLA-DMB-3989H
• Product Overview: Recombinant Human HLA-DMB protein(P28068)(19-218aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.4 kDa
• Protein length: 19-218aa
• AA Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: HLA-DMB major histocompatibility complex, class II, DM beta [ Homo sapiens ]
• Official Symbol: HLA-DMB
• Synonyms: HLA-DMB; major histocompatibility complex, class II, DM beta; HLA class II histocompatibility antigen, DM beta chain; D6S221E; RING7; MHC class II HLA-DMB; MHC class II antigen DMB; really interesting new gene 7 protein; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain
• Gene ID: 3109
• mRNA Refseq: NM_002118
• Protein Refseq: NP_002109
• MIM: 142856
• UniProt ID: P28068