Recombinant Human HIST1H2BK Protein, GST-tagged

• Cat.No.: HIST1H2BK-4790H
• Product Overview: Human HIST1H2BK full-length ORF ( AAH00893, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family. This gene is found in the histone microcluster on chromosome 6p21.33. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.60 kDa
• AA Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST1H2BK histone cluster 1, H2bk [ Homo sapiens ]
• Official Symbol: HIST1H2BK
• Synonyms: HIST1H2BK; histone cluster 1, H2bk; H2B histone family, member T , H2BFT, histone 1, H2bk; histone H2B type 1-K; H2BFAiii; H2B K; histone 1, H2bk; histone family member; HIRA-interacting protein 1; H2B histone family, member T; H2B/S; H2BFT; MGC131989
• Gene ID: 85236
• mRNA Refseq: NM_080593
• Protein Refseq: NP_542160
• UniProt ID: O60814