Recombinant Human HIF1A Protein, His&ABP tagged

• Cat.No.: HIF1A-003H
• Product Overview: Recombinant Human hypoxia inducible factor 1 subunit alpha Protein with His&ABP tag was expressed in E. coli.

Specification

• Description: This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Source: E. coli
• Species: Human
• Tag: His&ABP
• Protein length: 682-823 aa
• Form: Liquid
• AA Sequence: KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
• Purity: >80% by SDS-PAGE and Coomassie blue staining.
• Applications: This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100× molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
• Storage: At -20 centigrade, Avoid Freeze/Thaw Cycles
• Storage Buffer: 1M urea/PBS, pH 7.4
• Concentration: ≥5.0 mg/mL
• Shipping: Wet ice

Gene Information

• Gene Name: HIF1A hypoxia inducible factor 1 subunit alpha [ Homo sapiens (human) ]
• Official Symbol: HIF1A
• Synonyms: HIF1A; hypoxia inducible factor 1 subunit alpha; HIF1; MOP1; PASD8; HIF-1A; bHLHe78; HIF-1alpha; HIF1-ALPHA; HIF-1-alpha; hypoxia-inducible factor 1-alpha; ARNT interacting protein; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia inducible factor 1 alpha subunit; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor1alpha; member of PAS protein 1; member of PAS superfamily 1
• Gene ID: 3091
• mRNA Refseq: NM_001530
• Protein Refseq: NP_001521
• MIM: 603348
• UniProt ID: Q16665