Recombinant Human HIF1A, GST-tagged

• Cat.No.: HIF1A-106H
• Product Overview: Human HIF1A full-length ORF ( NP_851397.1, 1 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Hypoxia-inducible factor-1 (HIF-1), identified as one of the transcription factors, has been found to play an essential role in oxygen homeostasis. HIF-1 is a heterodimer composed of HIF-1β subunit and one of three subunits(Hif-1α, Hif-2( or Hif-3)). The activation of Hif-1( is closely associated with a variety of tumors and oncogenic pathways. Hif-1( consists of DNA binding domain(DBD domain), Dimerization domain and C-terminla regulatiory domains, including two transactivation domains(TAD), an oxygen-dependent degradation(ODD) domain, and inhibitory domains.
• Source: wheat germ
• Species: Human
• Tag: GST
• Form: Liquid
• Molecular Mass: 109.1 kDa
• AA Sequence: MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDA GDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICE PIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLF TKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDS DMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKG VIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGII
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ]
• Official Symbol: HIF1A
• Synonyms: HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA
• Gene ID: 3091
• mRNA Refseq: NM_001243084
• Protein Refseq: NP_001230013
• MIM: 603348
• UniProt ID: Q16665
• Chromosome Location: 14q23.2
• Pathway: Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem
• Function: Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding