Recombinant Human HIC1 Protein, GST-tagged

• Cat.No.: HIC1-4744H
• Product Overview: Human HIC1 partial ORF ( NP_006488.2, 627 a.a. - 705 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2010]
• Molecular Mass: 34.32 kDa
• AA Sequence: PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
• Official Symbol: HIC1
• Synonyms: HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901; zinc finger and BTB domain-containing protein 29; hic-1
• Gene ID: 3090
• mRNA Refseq: NM_001098202
• Protein Refseq: NP_001091672
• MIM: 603825
• UniProt ID: Q14526