Recombinant Human HIC1 Protein, GST-tagged
Cat.No. : | HIC1-4744H |
Product Overview : | Human HIC1 partial ORF ( NP_006488.2, 627 a.a. - 705 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 34.32 kDa |
AA Sequence : | PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIC1 hypermethylated in cancer 1 [ Homo sapiens ] |
Official Symbol | HIC1 |
Synonyms | HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901; zinc finger and BTB domain-containing protein 29; hic-1; |
Gene ID | 3090 |
mRNA Refseq | NM_001098202 |
Protein Refseq | NP_001091672 |
MIM | 603825 |
UniProt ID | Q14526 |
◆ Recombinant Proteins | ||
HIC1-4160M | Recombinant Mouse HIC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HIC1-1409H | Recombinant Human HIC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HIC1-29312TH | Recombinant Human HIC1 | +Inquiry |
HIC1-6789C | Recombinant Chicken HIC1 | +Inquiry |
HIC1-463Z | Recombinant Zebrafish HIC1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIC1 Products
Required fields are marked with *
My Review for All HIC1 Products
Required fields are marked with *
0
Inquiry Basket