Recombinant Human HIC1

Cat.No. : HIC1-29312TH
Product Overview : Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 79 amino acids
Description : This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants.
Molecular Weight : 34.320kDa inclusive of tags
Tissue specificity : Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG
Sequence Similarities : Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers.
Gene Name HIC1 hypermethylated in cancer 1 [ Homo sapiens ]
Official Symbol HIC1
Synonyms HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901;
Gene ID 3090
mRNA Refseq NM_001098202
Protein Refseq NP_001091672
MIM 603825
Uniprot ID Q14526
Chromosome Location 17p13.3
Pathway Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem;
Function DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HIC1 Products

Required fields are marked with *

My Review for All HIC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon