Recombinant Human HHIP Protein, GST-tagged

• Cat.No.: HHIP-4737H
• Product Overview: Human HHIP partial ORF ( NP_071920, 21 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein similar to the mouse hedgehog-interacting protein, a regulatory component of the hedgehog signalling pathway. Members of the hedgehog family are evolutionarily conserved proteins which are involved in many fundamental processes in embryonic development, including anteroposterior patterns of limbs and regulation of left-right asymmetry. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HHIP hedgehog interacting protein [ Homo sapiens ]
• Official Symbol: HHIP
• Synonyms: HHIP; hedgehog interacting protein; hedgehog-interacting protein; FLJ20992; HIP; FLJ90230
• Gene ID: 64399
• mRNA Refseq: NM_022475
• Protein Refseq: NP_071920
• MIM: 606178
• UniProt ID: Q96QV1